PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589176.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 825aa    MW: 93302.5 Da    PI: 5.7381
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589176.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK505.9e-16636680448
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                      is ++l+++F +++ dAAk+Lgv  ++LKr CR y I RWP+ k
  XP_009589176.1 636 GISRSVLEEQFGKKLSDAAKSLGVARSTLKRMCRDYDIYRWPRSK 680
                     6999**************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.843621706IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.602.6E-4622672IPR009057Homeodomain-like
PfamPF020424.2E-13637680IPR003035RWP-RK domain
SuperFamilySSF542776.87E-17738823No hitNo description
PROSITE profilePS5174518.234741825IPR000270PB1 domain
SMARTSM006662.4E-15741824IPR000270PB1 domain
PfamPF005647.6E-15742823IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.7E-15743822No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 825 aa     Download sequence    Send to blast
MPIELKFSYR KRGDGINRWV FWTQHNGDEL NQVKSLFPVL RDSTQPDTNG DSQLNRLTIK  60
NLVELLDVQG TCLIQFWAPI RINSGKTFLT TADQPFAFNG KIHEGLWAYR RVSLLTIASV  120
DSTEIDETKR VHVHGRPARV FRSGMPEFSP HVRYYYMDEY PLRNFAMCLG VGSYWTLPVF  180
ESSGDRCIGV LEYAFEANVG LDLYSTLDCL INNHRILKTM GLALIPSWLA CSQEIQEVWE  240
QELAKVKEAL EVTCKTHRLL FAQTWISVLD SSRTQMLITS PPTKYWSEEI TSLEFLAVSD  300
LHHVRIGQGL VGKVLSSKGS CFCRDITQLS IDFYPFVPIA RCAGFTACFA IFVRLNSACH  360
MVLEFFLPND ETLDRNPQSF LSKLLATIRE QLPSFFLDSG PSLFVEVIRT APVDELDSFE  420
ISQLQQGVRS KGNEKMVLFD SLNQDSADLG PSSSTDIGAH HMEIAKDTPD NGEETVLPDS  480
AHKQGVEEAD AMDKEKSSVD FILATSFAVS EKKLQQNLST DKASLDEKLD SFEIGHRQLP  540
SMVQYDTINQ IFGFDPSSSS DLEEIITADY GRDTQLNLQS KKRGESTQPD LAHQQRVEEA  600
DVGDKRRHSV HVEENANSHN CPEKHKRIKR IEKEYGISRS VLEEQFGKKL SDAAKSLGVA  660
RSTLKRMCRD YDIYRWPRSK SANDVCSLSE NKPVKRVENQ TGNSSREDLQ LPHAGLSNGM  720
DTTTTLTQRK KPTATFQSDN AMSVKVTYKD VTIRFPFSLS SGKIDLETEV EKRLKLVLIG  780
SYSIKYEDED NDWIAITCDS DLEYGMHTLR SLGRTTMKML VEPLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589176.10.0PREDICTED: protein NLP7-like isoform X4
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.13e-41NIN like protein 7